Apollo Biotech

RESEARCH USE ONLY: These products are strictly for laboratory research purposes and not for human consumption.

Back to Knowledge Base

TB-500

Thymosin Beta-4 Synthetic Analogue

Peptide Profile

Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Molecular Weight

4963 g/mol

Storage Requirements

For maximum stability, store the lyophilized powder at -20°C (or -80°C for long-term preservation) protected from light and moisture. Once reconstituted with bacteriostatic water or sterile saline, the solution should be kept refrigerated at 2°C to 8°C and utilized within 14–21 days. Avoid repeated freeze-thaw cycles and keep vials tightly sealed until use to maintain compound integrity.

Relevant Literature

Recent in-vitro studies:

Selected in-vitro / cell-based PubMed literature relevant to this compound:

  1. Reference 1

    S Esposito et al. (2012). Synthesis and characterization of the N-terminal acetylated 17-23 fragment of thymosin beta 4 identified in TB-500, a product suspected to possess doping potential. Drug Test Anal. PMID: 22962027.

    View on PubMed
  2. Reference 2

    E N M Ho et al. (2012). Doping control analysis of TB-500, a synthetic version of an active region of thymosin β4, in equine urine and plasma. J Chromatogr A. PMID: 23084823.

    View on PubMed
  3. Reference 3

    K A Rahaman et al. (2024). Simultaneous quantification of TB-500 and its metabolites and their comparison of biological activity in fibroblasts. J Chromatogr B Analyt Technol Biomed Life Sci. PMID: 38382158.

    View on PubMed